- Source: Peritrich nuclear code
The peritrich nuclear code (translation table 30) is a genetic code used by the nuclear genome of the peritrich ciliates Vorticella and Opisthonecta.
The code (30)
AAs = FFLLSSSSYYEECC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = --------------*--------------------M----------------------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).
Differences from the standard code
See also
List of all genetic codes: translation tables 1 to 16, and 21 to 31.
The genetic codes database.
References
This article incorporates text from the United States National Library of Medicine, which is in the public domain.
Kata Kunci Pencarian:
LEGO Marvel Avengers: Code Red (2023)
Action, Animation, Bioskop Online, bioskop21, BioskopKeren, Drakor ID, DrakorIndo, DramaQu, Dunia21, DutaFilm, Family, Ganool, gudangmovie, gudangmovie21, IndoXX1, Indoxxi, KorDramas, LayarKaca21, Layarkaca21 INDOXXI, LK21 XXI, Nonton drama, Nonton Movie, Pahe.in, PusatFilm21, Denmark, USA
Ken Cunningham
Mission: Impossible – Ghost Protocol (2011)
Action, Adventure, Bioskop Online, bioskop21, BioskopKeren, Cinemaindo, Drakor ID, DrakorIndo, DramaQu, Dunia21, DutaFilm, Ganool, gudangmovie, gudangmovie21, Indoxxi, KorDramas, LayarKaca21, LK21, LK21 XXI, Nonton drama, Nonton Movie, Pahe.in, PusatFilm21, Thriller, USA
Brad Bird
Thunderball (1965)
Action, Adventure, Bioskop Online, bioskop21, BioskopKeren, Dewanonton, Drakor ID, DrakorIndo, DramaQu, Dunia21, DutaFilm, Ganool, gudangmovie, gudangmovie21, LayarKaca21, Layarkaca21 INDOXXI, LK21, LK21 XXI, Nonton drama, Nonton Movie, Pahe.in, PusatFilm21, Thriller, United Kingdom
Terence Young
The Abyss (1989)
Action, Adventure, Bioskop Online, bioskop21, BioskopKeren, Cinemaindo, Dewanonton, Drakor ID, DrakorIndo, DramaQu, Dunia21, DutaFilm, Ganool, gudangmovie, gudangmovie21, IndoXX1, Indoxxi, KorDramas, LayarKaca21, Layarkaca21 INDOXXI, LK21, LK21 XXI, Nonton drama, Nonton Movie, Pahe.in, PusatFilm21, Science Fiction, Thriller, USA
James Cameron
Dr. Strangelove or: How I Learned to Stop Worrying and Love the Bomb (1964)
Bioskop Online, bioskop21, BioskopKeren, Celebrities, Cinemaindo, Comedy, Dunia21, DutaFilm, Ganool, gudangmovie, gudangmovie21, IndoXX1, Indoxxi, KorDramas, LayarKaca21, Layarkaca21 INDOXXI, LK21, LK21 XXI, Nonton drama, Nonton Movie, Pahe.in, PusatFilm21, War, United Kingdom
Stanley Kubrick
The Spy Who Loved Me (1977)
Action, Adventure, Bioskop Online, bioskop21, BioskopKeren, Drakor ID, DrakorIndo, DramaQu, Dunia21, DutaFilm, Ganool, gudangmovie, gudangmovie21, IndoXX1, Indoxxi, KorDramas, LayarKaca21, Layarkaca21 INDOXXI, LK21, LK21 XXI, Nonton drama, Nonton Movie, Pahe.in, PusatFilm21, Thriller, United Kingdom, USA
June Randall
No More Posts Available.
No more pages to load.
